DPCstruct | MC18140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 113 ± 32 aa |
| Standard deviation of domain lengths | 32.46 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | PF02788- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9QPQ9 | 3-74 | ALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACE |
| A0A2G2VNE7 | 80-184 | LEGVLHVASGGIHIWHMHTLTEIFGDESILQFSGGTLGHPWGNVLGALANRVALEACVKARNEGRDLSREGNEIIHEASKWSPELAA… |
| A0A4S8I5Y7 | 263-395 | None |
| A0A7C7Q6H3 | 2-75 | None |
| A0A4S8I6E4 | 2-88 | None |
| A0A2G3ATE3 | 28-132 | None |
| A0A1J6IDB3 | 77-202 | None |
| A0A7C1GBG0 | 4-83 | None |
| A0A2G3CMJ7 | 171-256 | None |
| A0A7C1PSN2 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.