DPCstruct | MC1814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4Q0K9 | 1-104 | MPRSLGKRLPMPEYRPLNPWTERRALFGQNDYIDILGSGELHPLRTLYTIPSWIKGVSGNEYQILLRKKKMFAKTGSPQVRPTKWKE… |
| A0A183IJF6 | 9-162 | LAKCDVRVPLRAIHDVSKVPRVRDRTNAHLKVSDYGYVWNYHQEGQPLPRMKDCMVPVKTVPYKVRDMWTKEKALFGQNDYIDLLGD… |
| A0A7E4RQB7 | 58-229 | None |
| T1H5E7 | 16-127 | None |
| A0A0V1DFV5 | 11-113 | None |
| A0A5K3FEY8 | 151-292 | None |
| A0A821QGQ7 | 707-861 | None |
| A0A5J4NZ89 | 132-275 | None |
| A0A154P204 | 16-134 | None |
| A0A5B7DT44 | 9-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.