DPCstruct | MC18139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 151 ± 27 aa |
| Standard deviation of domain lengths | 27.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 53.26 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | PF00223- PF05695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JVS6 | 4-156 | KFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWITDPLNIRPIAHA… |
| A0A2G2VMS8 | 1-147 | MIIRSPEIEVKILVDRDPVKTSFEEWAIPVHYSRTIAKGLDTTTWIWNLHVDAHDFNSHTIDLQEISQKLFSAYFGQLSIIFLWLSG… |
| A0A4S8I2Y4 | 1-178 | None |
| A0A2G3ASB3 | 7-172 | None |
| A0A6P5MEV9 | 2-173 | None |
| A0A2G2XC02 | 1-125 | None |
| A0A444X2Y5 | 67-186 | None |
| A0A2G2X906 | 11-160 | None |
| K7X1M8 | 15-169 | None |
| A0A4Y7J9A2 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.