DPCstruct | MC18137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 134 ± 24 aa |
| Standard deviation of domain lengths | 24.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.16 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF17846- CL0036- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5CKC9 | 81-194 | QFLNIFVLREYLQYDLDIPNPPFEINFERILDDFVFLCFFVGNDFLPHMPTLEIREGAITLLMYIYKREFASMGGYLTDAGEVLLGR… |
| A0A2G2VGP1 | 341-471 | VLREYLQYDLEIYNPPFQIDFERVVDDFVFLCFFVGNDFLPHMPTLEIREGAINLLMFIYRRDFTTMGGYLTDAGEVFLDRVEHFIQ… |
| A0A816CND5 | 107-243 | None |
| A0A7S3PKU7 | 18-136 | None |
| A0A6P3Z399 | 10-122 | None |
| A0A0R3QFT5 | 107-196 | None |
| A0A0D9XP87 | 2-116 | None |
| A0A446Q6Y1 | 229-405 | None |
| L8YF78 | 117-279 | None |
| A0A2G5DN20 | 194-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.