DPCstruct | MC18133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 64.72 |
| Pfam Score | 87.14 |
| Assigned Pfam label(s) | CL0023- PF16880 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453SSZ1 | 71-147 | SSKKIPLTAVTSVIDGLKRLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPG |
| A0A2G2UYF4 | 9-89 | LQHEMQIQPCVTAVTSVSGGLKGLYNEKLKPLERTYRFNDFASPTLTESDFDAKPMVMLLGEYSTGKINFIKHLLKCNYPG |
| A0A5D2K812 | 1-77 | None |
| I1HIL5 | 1-61 | None |
| A0A5N5IJ82 | 220-310 | None |
| A0A287XKV9 | 250-341 | None |
| A0A835NSJ9 | 1-75 | None |
| A0A1R1XUG5 | 1-91 | None |
| A0A1S4BC07 | 142-214 | None |
| A0A7J5XPK5 | 5-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.