DPCstruct | MC18132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 220 ± 40 aa |
| Standard deviation of domain lengths | 40.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 38.72 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF00346- PF02468- PF00124- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804RMR8 | 2-226 | YEQGLILLPHLATLGWGVGPGGEVLDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILL… |
| A0A2G2UWS3 | 3-242 | FPWYRVHTIVLNDPDQLLSVHIMHTALVTGWADSMALYELAVFYPSYPVLDPMWRQGGTVTNLGIWSYEGVPGEHIVFSGLRILEAI… |
| A0A4Y6I528 | 33-297 | None |
| A0A5A7QQX8 | 13-186 | None |
| A0A6A4NTL6 | 64-303 | None |
| A0A7J9HTE2 | 2-182 | None |
| A0A650G361 | 33-291 | None |
| A0A1Y3BX75 | 113-352 | None |
| A0A0D3GJW3 | 2-155 | None |
| A0A5A7T7Y5 | 127-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.