DPCstruct | MC1813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7WEL0 | 25-115 | NAPIKCSELPATNLYEWLDRNFCVVDQRVINMGKNRRITPCVTCTCTAEGPECHSITIERCEELFEDYLLNEIKKDTVCVIQCARAI… |
| A0A183IJ38 | 7-108 | VNCNSIEDMDLTYWTEAGSCTMNGVSFPLGHTRRITPCVSCTCTSYGVQSFYDKSLLSRPLLQPECQAIRVVDCRSLLSDYELSDIL… |
| A0A7R9QD74 | 66-152 | None |
| A0A0D8Y6W0 | 71-156 | None |
| A0A0D8Y3I3 | 472-556 | None |
| A0A2H2JH52 | 1-86 | None |
| A0A0B1T0K4 | 212-297 | None |
| A0A2K6WMI1 | 1348-1436 | None |
| A0A0K0EXE9 | 151-235 | None |
| A0A0R3R3V9 | 124-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.