DPCstruct | MC18126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 231 ± 23 aa |
| Standard deviation of domain lengths | 23.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9TER4 | 2-241 | CCERISQYLQKYFNPNKIEKGYSLAISSGRNGARLSHSHEMQYLYANQTLHLWREIQHEMFMLWSLSDQDLLSDHNTYRLRDTGQGL… |
| A0A7S3A7Y8 | 1-220 | RGCQRYVGSAQYVSQSVGTGRAKSETRFVLENLSVSAHRYKLWYLAEKDLLSADHQYSLRSSLQGLCRIQSAPNVSKAMKEILSRVK… |
| A0A3M6V984 | 101-343 | None |
| A0A2R5GPF5 | 374-601 | None |
| A0A812RD47 | 230-471 | None |
| A0A7S0TIH1 | 28-267 | None |
| A0A1J8QJG4 | 805-1046 | None |
| A0A3F2RS75 | 317-553 | None |
| A0A504X1H7 | 199-446 | None |
| A0A5B8MQT8 | 806-1043 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.