DPCstruct | MC18125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 156 ± 32 aa |
| Standard deviation of domain lengths | 31.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | CL0187- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3A615 | 37-191 | GPSGRDGGACNLYILHEVGDTDTIQGLSLRYEVDTDLICRYNALMSQHHLTHRSQVFIPVVHEEQRMWYKEKTGDIVYDPHVGREYV… |
| A0A6M2E6T8 | 184-326 | AISHKIVKGDSVASLAVKYSVQVMDIKRINNMTSDHGIYSRERLLIPIINPNLLINETCYIELDTYANREVAVLYPEGKPDEKLMSK… |
| A0A822XK52 | 1-140 | None |
| A0A423X9I1 | 588-749 | None |
| A0A194VPF9 | 78-219 | None |
| A0A6D2L748 | 335-468 | None |
| G3J7F7 | 5-133 | None |
| A0A7S4P1W7 | 26-148 | None |
| A0A2K1J788 | 332-467 | None |
| A0A146IMP5 | 167-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.