DPCstruct | MC18123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7P231 | 1-133 | MEEEEYYYYDDDYGNEEGEAWEAALENEYVTAKSMMDTMPEECAAGLRGVARDDPVGGRWSFKAFKMLVRVCRRMGSYEEMLSYYNK… |
| A0A7S3A2X7 | 1-139 | MSDEEDYGFEYSEDEEDTEDVEIENKYYEAKRSVESDPDLTLKEMDAVIEMEQEQGQWGFKALKQIVKILFRRGQYDEMLKRYKEML… |
| A0A7R8XFK1 | 1-150 | None |
| A0A4S4M3G1 | 50-195 | None |
| W7TTN0 | 13-150 | None |
| A0A016WE95 | 1-143 | None |
| A0A183BQE5 | 1-144 | None |
| A0A1I7XQC4 | 300-431 | None |
| L8WR85 | 4-171 | None |
| A0A0D2KFH1 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.