DPCstruct | MC1812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 217 ± 27 aa |
| Standard deviation of domain lengths | 26.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9V218 | 44-238 | FNQDCQALKIMFSSLFDIYSSFISTLCYKCHDIGILCNAITYLKDEQILYRLPHSKLIQLPEYSIFNFCVNELVTNISERLVYLSLN… |
| A0A2P2K4Z9 | 143-347 | MDPLSTYLYDTLRPKLIHETNIDRLCELINILKVEVLGEQLGRRSESLAGLRPTLERILADVHERLTFRARTHIRDEIANFFPSDED… |
| A0A2V2WYQ4 | 47-218 | None |
| A0A453RTV3 | 288-485 | None |
| A0A1Y1XVX4 | 395-632 | None |
| A0A1U8F5U8 | 5-236 | None |
| A0A3R7X617 | 2-200 | None |
| A0A553RAF8 | 84-320 | None |
| A0A3M7SJE4 | 168-386 | None |
| A0A397DIT4 | 131-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.