DPCstruct | MC18116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9C5C4 | 1-131 | MSLKDLTEKTARKWLHERGVDIEDIAKLVFLLQEKYHKDLQMEDCIHNVERVLSKREVQNAIITGIQLDVLAEKKLLESPLQEIVET… |
| A0A2K9AR82 | 2-149 | VVDTLEKRGVKLEDIAEITYDLQKKYIPNLTLEYCLEHVKKVVKKREVQHAVITGVELDVLAEKGLLSEPLSTILLNDYGLYGIDEI… |
| A0A1G5IAB3 | 53-222 | None |
| A0A7T5M7X0 | 7-161 | None |
| A0A644SU42 | 281-434 | None |
| A0A7C5U9B1 | 216-366 | None |
| A0A1V4FJC4 | 3-163 | None |
| A0A2A8TKZ5 | 2-159 | None |
| A0A1I0AWS2 | 220-351 | None |
| A0A7C6ZIJ2 | 9-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.