DPCstruct | MC18114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 23 aa |
| Standard deviation of domain lengths | 22.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7Z0D0 | 135-230 | TTGQARAELEEWTGGKALDPLDEDAVPRIVLVAAGFPVGVTNTVLWLTRNFDMDITCVQVTPYTVAGEIVLAASVLIPLPEAAAFEV… |
| A0A1F4K3E5 | 1-131 | MNKSEFDATKSIEEFIDTDIEALNANQRIILASREFNSEVISAVLWLREFGVDIQCTRLAPFVDSDGELFIKPETIIPLPEAKDYIE… |
| A0A3R9YHS2 | 122-225 | None |
| A0A7X8UAV3 | 78-193 | None |
| A0A0B8PG18 | 1-96 | None |
| A0A7C1QA47 | 68-179 | None |
| A0A1H9T202 | 3-144 | None |
| A0A1V4GPN8 | 72-181 | None |
| A0A6B0Z4H4 | 67-220 | None |
| A0A2A9E6S4 | 130-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.