DPCstruct | MC18112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 410 ± 61 aa |
| Standard deviation of domain lengths | 61.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380CST5 | 24-472 | ILGYPGRTFRHRPAQYIAYQQQFLLPYTSELYDFQNKQMELAGKDDKVTELALATRIKRNANVLKNYRGKLKGLRNIDLISSKKQED… |
| A0A7C1JU66 | 389-780 | ARRAQDDLFGVQNARKAYLGRLAGLHDPAVMQQKAAAEKALRAAVENDSKLKQQCGDPWQDVAATLPIWNKVFLRYDLLERGAAFNC… |
| A0A1G0LAI3 | 75-515 | None |
| A0A812Q9R4 | 648-1125 | None |
| A0A3G8M0L0 | 237-724 | None |
| A0A848Y125 | 150-592 | None |
| A0A1E7FFS7 | 220-636 | None |
| A0A7V1MHE0 | 44-449 | None |
| A0A426H5P7 | 37-456 | None |
| A0A6A0IC66 | 3-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.