DPCstruct | MC18111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 324 ± 45 aa |
| Standard deviation of domain lengths | 44.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1FY22 | 61-404 | GSAVRWVMFNVQGKSKNRRGTIAVLTVACLIMLLAMVGFAVDMGYIVLVRTQLQVAADSAAIAAAWARLDSPLPQVLATAQDYASRH… |
| A0A538U947 | 57-390 | EPMLARKHDPKARGVIILWFAFFLMLMLGFLALGIDVAKLMATRTQLQTAADAAALAGISAMSPVTGTVVQDAAILRAQDASTHNKA… |
| A0A521UDT4 | 60-411 | None |
| A0A521UE33 | 21-369 | None |
| A0A7K3WAR9 | 4-341 | None |
| A0A7V5PA67 | 1-319 | None |
| A0A7C2XNZ5 | 96-554 | None |
| A0A1F7X5K5 | 14-327 | None |
| A0A7C6DPA3 | 1-358 | None |
| A0A1F6L955 | 1-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.