DPCstruct | MC1811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.64 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0707- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9N3B0 | 91-168 | MPTEKVCLEKLKGKDAQICELKYDKPLDWKTIDLKKMRVKELKNILGEWGEVCKGCTEKAELIKRIEELKPKYVKEEL |
| A0A183IF10 | 12-88 | MPPEKICERLRSKDGQICELKYEKQIDWKTVDLSKLRVKELKKILDDWGERCKGCTEKSEFVSQIKSLMPKYVKAEL |
| U3K2R2 | 108-200 | None |
| A0A836CZW2 | 95-169 | None |
| A0A3Q7W4H9 | 304-396 | None |
| A0A7J5ZGG6 | 115-200 | None |
| A0A0V1ENF2 | 94-167 | None |
| A0A444U674 | 69-150 | None |
| A0A0N4UC71 | 73-158 | None |
| A0A1V9X9S2 | 85-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.