DPCstruct | MC18107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Standard deviation of domain lengths | 18.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2EX02 | 230-369 | HPESIVHSLVSFADGAMMAQLGYPDMKLPIQLALTYPERLPCVKQLDLVSLGALHFYPLPKEKFPCYSLALAAGKAGGTAPTVLNAA… |
| A0A6M8W9B9 | 3-107 | RARKAAQRALDWHRLGRLDFCEPDAGRFPAIGLAMDVIRRGGGAGAVLNAANEVAVEAFLAGDIPFGRIVEIVGETVARVSSDRGES… |
| A0A7V5KX67 | 11-119 | None |
| A0A1F8LM19 | 161-305 | None |
| A0A834SZW7 | 77-190 | None |
| A0A3M0Y3N0 | 1-128 | None |
| A0A7J6U9H5 | 577-726 | None |
| A0A7V5C3S6 | 253-376 | None |
| A0A1Y5IQX7 | 164-309 | None |
| A0A655N0F8 | 22-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.