DPCstruct | MC18106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 155 ± 25 aa |
| Standard deviation of domain lengths | 24.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4KGD8 | 56-211 | KKKAVSYEVEDSANKLLSFQEIINAISNELSMWIALKDDDAGLAWDCLVNAQMAVKTAMQAHSVASHLDNYSSHLSILEHHLFPKQM… |
| A0A6M8W0R6 | 6-170 | TRLKGDAVATRDEAIANELLAYEYMLDALANELDMYIALKQDAPGRAWTHLVNAQMAASHAVKAHEVAARLELLYIPRLHALERLCF… |
| A0A2P8C6L3 | 50-214 | None |
| A0A373NU71 | 9-136 | None |
| A0A7W0UI42 | 6-199 | None |
| A0A1G8C681 | 34-206 | None |
| A0A2I2M2M9 | 43-198 | None |
| K2RW10 | 198-410 | None |
| A0A0F9RH60 | 18-152 | None |
| A0A4Q3M0A2 | 27-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.