DPCstruct | MC18102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A176ZZY4 | 24-115 | ELRKALIEEHSNEQPPSDGEIYCKIRKYQQKRDRYSEMRWWARPSGHGTRCLDQVSRHPDFKAAFDDLLDIPGLWGGMRISTLNRMI… |
| A0A2D5SQU9 | 3-99 | PEAQAALGEDYSNSLNFADGEIYGKIRDYQRRNKPFAERRWRAYLSKSKQKGLGQLLKRERYKDAFDALLVVRGLWPGPGFSLGNMQ… |
| A6RCM2 | 78-175 | None |
| A0A7C8H495 | 140-235 | None |
| A0A094ATK9 | 119-204 | None |
| A0A0F4Z3T0 | 73-181 | None |
| A0A2D5SEZ0 | 9-121 | None |
| A0A5J5EKJ2 | 4-105 | None |
| A0A2D5SNT3 | 1-126 | None |
| L7HPC7 | 124-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.