DPCstruct | MC1810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 190 ± 28 aa |
| Standard deviation of domain lengths | 28.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.04 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0226- PF12999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7V6X1 | 48-229 | ETFACLDGNKVTPFNQVNDDYCDCADGSDEPGTAACRNGKFYCKNYGYKPSLIPSSRVNDYICDCCDGSDEWDSGTECPNVCEALGS… |
| A0A183ICX2 | 2-176 | CLDGSRTIPFEWVNDDYCDCRDGSDEPGTAACPNGSFHCANLGHLPLNIPSSRVNDQICDCCDGSDEYSGWVHCPNTCEEMGRKMRE… |
| A0A4P9WKG2 | 16-238 | None |
| A0A183H8G0 | 44-212 | None |
| A0A813F9M6 | 609-819 | None |
| A0A813AEX8 | 895-1068 | None |
| A0A7N6AAH0 | 5-231 | None |
| A0A446PP73 | 43-216 | None |
| A0A6S8T6M1 | 30-201 | None |
| A0A418B3D2 | 29-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.