DPCstruct | MC181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 302 ± 34 aa |
| Standard deviation of domain lengths | 33.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0DIY5 | 3-243 | RKIRGIFRRLVCRWRTRRIDAKPQDLIDPITFMPIEQLVTVYDMEQRRKYCFDAMSLIKCITKDLFRQQYTIPSPQMPKNVVTNRPF… |
| A0A6C0BVQ6 | 21-296 | LYSLIKMREFNIKNVAFFWCDYTQKLQKIKMLMENTFLNNKAKDEFLVNFARFQRTLNAFKKLVKMWRIKKKFLFYPNTTDLKGNEL… |
| A0A381TRR3 | 16-283 | None |
| A0A6C0FCZ6 | 74-385 | None |
| A0A6C0L0E7 | 64-401 | None |
| A0A6C0LPD9 | 65-366 | None |
| A0A6C0D9L3 | 46-341 | None |
| A0A6C0IEY9 | 13-332 | None |
| A0A6C0LD92 | 16-340 | None |
| A0A6C0ID72 | 65-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.