DPCstruct | MC18098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 560 ± 101 aa |
| Standard deviation of domain lengths | 101.31 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 11.38 |
| Pfam Score | 51.05 |
| Assigned Pfam label(s) | PF11915- CL0028- PF11374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5PIN5 | 3-539 | ISLAFAGLFGGLGHHLYNDGLQGQPVIDAQWPQRWGVAMAFFVKMTLVGSVQIAVKQRAWLTVKKRGFRVRTLDSIFHACYDPLEFF… |
| A0A094FAA7 | 21-551 | ALFTASLALICLACYALLIILYIQADLYHIPSLVTDGDTGSIKPTVAVSLIAAVLAAATSALITRCVEHSFWLKLVPGNVGSPLTVG… |
| A0A284QN03 | 319-868 | None |
| A0A146HEU3 | 567-1097 | None |
| A0A178EFA4 | 1-518 | None |
| A0A366R3L4 | 247-866 | None |
| A0A1J9RBT4 | 560-1159 | None |
| A0A2H3GGL5 | 31-552 | None |
| A0A4Z0Z686 | 24-570 | None |
| W9WYN8 | 1-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.