DPCstruct | MC18097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 170 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07956 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0P4P4 | 1-146 | MGSTTSKPETKVFTPNAPVDFSASFLSHLENSQESDYTRAQYTEKYIQERVASELSKLEAEAQQKFKDATNNALEKSKDAKVSVAQS… |
| U1HJK2 | 498-664 | FSQELVDSLQASSETNASRAKALELHIASRVAAELAALERKEDETLRSLRESLSSELSSSSTTPSKDQSNESRLLDLPSIPAPADAA… |
| A0A2J6SUQ2 | 1-169 | None |
| A0A139HJ29 | 1-205 | None |
| A0A060TCK3 | 29-173 | None |
| A0A5M8PYY6 | 1-192 | None |
| C5P6S7 | 1-194 | None |
| A0A1U7LVR6 | 4-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.