DPCstruct | MC18095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0167- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3B9I8 | 185-270 | KIKFDPGFIPPPLDVKKHLELLRSELDPNHPWYAPEYQHTNLRAIIRLYEEGKIDGQKRIYVQDGKIVSREQAFKGPAPSLVDGMF |
| C0NRK4 | 1-103 | MSSRPFNPLPVCPIPIQWDVPGRIAELQAKIDDPATSEAQKINLQTAIKLYHDKELPGRLKWIQDGKVVQLKDIDFHRPHWTEGHLQ… |
| E4UPA9 | 1-95 | None |
| E4UZQ0 | 3-87 | None |
| E5QZI2 | 1-102 | None |
| A0A1B8F4T2 | 3-112 | None |
| A0A101MF99 | 65-153 | None |
| A0A178EQ96 | 80-145 | None |
| F2SK35 | 3-91 | None |
| A0A094F8Z1 | 171-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.