DPCstruct | MC18094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 292 ± 64 aa |
| Standard deviation of domain lengths | 63.51 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D8Z341 | 49-346 | EPRRLDVNDPRAVEFREHIRMWFEQRSWESLKKDDILLWLAWAAFGVDLKVAQQDPKRTRFLDRTFKMIEARTGTVFPEGSSGVAVM… |
| A0A6V3JCJ3 | 14-321 | SVPGCTLALLAFVLAAACGQAGALLCAVELAYAAYYFAAKKPRIQPVRPAPQMTAAERWDLWKRCIAHVPSVEGFSRGWFRYLEDDL… |
| A0A1Y2HS99 | 137-423 | None |
| B8PJL3 | 1-217 | None |
| G4N804 | 2-166 | None |
| A0A813FP13 | 1-189 | None |
| A0A0G4HF41 | 3-291 | None |
| A0A0B4H1X8 | 1-374 | None |
| A0A2V1CWS3 | 25-322 | None |
| A0A6A5ZNE2 | 1-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.