DPCstruct | MC18092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7G2P8 | 94-201 | AAQWRVQRRAEARELVRADPGLAWELRIGRPDIQGRQYDDGGLVDVNHVPAAWLAYSLQIPQPLADEIAQQRGLRQGFTSPDELIVY… |
| A0A850CCE4 | 1-103 | DQAARLREDALRLADGDPSLAKRSGVGRPDQPRHLDDGGLVDLNHAPADVLRDLPGFNAALAEQVRERVERIGPFQSLDEVIVEIGV… |
| A0A1C5J5U1 | 174-296 | None |
| A0A562UY30 | 251-352 | None |
| A0A5M3WBZ8 | 62-166 | None |
| A0A4R1HSP4 | 239-344 | None |
| A0A6I1YG07 | 113-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.