DPCstruct | MC18088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 117 ± 32 aa |
| Standard deviation of domain lengths | 32.42 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1PD88 | 8-93 | HNQEKVSAEFHDAYKSVGKGRNFVRIHRIREFLKWPDQTFDSVLKSLMNAYAVELHGGDPSSMSEKEIADSYKDENGRLFLTISWR |
| A0A2T0UEN8 | 74-187 | GSKVAAAAWFKRHPLTEVEFAGPEHVEGATGTEHIQAAILTLIKTGTWASLAGLRAKFGTAIARDRIDQALTDLVTARKIILIPESN… |
| A0A327KT13 | 68-176 | None |
| A0A0M1JDZ6 | 281-389 | None |
| A0A3D1TFG4 | 198-300 | None |
| A0A3S0CUG4 | 52-139 | None |
| B3DZI2 | 95-186 | None |
| A0YY26 | 6-222 | None |
| A0A1Y5XJK6 | 6-173 | None |
| A0A428XUG2 | 37-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.