DPCstruct | MC18087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 161 ± 23 aa |
| Standard deviation of domain lengths | 23.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.46 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0465- PF08518 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0WD29 | 405-587 | AALEVELSKQLHASVRSGNLETSLRLVVQGADPNYFHDEKGSTPLHVAARSGQLSQMELLLVYGADVNALDSQGNTPLDLAKACKQS… |
| B4K101 | 2-137 | AAKFGQASQIEMLLIYGADVNALDGNGMTPLELAKANNHSTIAERLLDAMYDVTDRLIVFMGGKKPDHACGRHLIIPDTNSGEISEQ… |
| A0A1I8H6U6 | 1-208 | None |
| A0A7R9CVV1 | 175-322 | None |
| T1GK81 | 15-152 | None |
| A0A7E4VFA0 | 37-207 | None |
| A0A4S2JZ84 | 113-282 | None |
| A0A0C2H0G9 | 17-147 | None |
| A0A6H5J6C2 | 594-745 | None |
| A0A553NE86 | 156-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.