DPCstruct | MC18085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6TU87 | 107-177 | GDGKLGTIYMVGDNPSSDIQGANNFTSRLGTEWKSILVESGVHVAGAEPAHKPDAIMKSVKEAVEWAFWNA |
| A0A482R4Q7 | 1-80 | MEAMAAPVHDDSFVQLYHVGDNPAADIRGALNAGDPWRGILVRTGIFTGTADENARSPHPAHAVVPDVMHAVQHVLSNAV |
| A0A7S4ICD6 | 79-153 | None |
| X0MEE7 | 269-348 | None |
| C9SBI5 | 9-72 | None |
| A0A0B7JV66 | 259-333 | None |
| A0A2P2L4H5 | 123-196 | None |
| A0A397BBW8 | 168-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.