DPCstruct | MC18082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 142 ± 26 aa |
| Standard deviation of domain lengths | 26.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U1P0V0 | 29-159 | HAATSQDGQKTDLGDNVAFKTPSGKTRCMTDNIQPGTLSCLVNLTNPPKRPAGTEGNWVGGWTDFSGRQVTVGGLHGDPGPFQSGDG… |
| A0A5N0EGE5 | 19-154 | LTASPATAQPGDLDEWTPVDYTEYLATDAEHSGGLYFRTPDGRNCAFHWNSGPVGCDAVSLDAPAGTNQIRASIIEPAHFVTADHPT… |
| A0A212TGG8 | 33-200 | None |
| A0A1A2M9S6 | 10-134 | None |
| U1PSV9 | 150-258 | None |
| A0A6L7GMP1 | 37-184 | None |
| A0A1Q9BYB3 | 335-477 | None |
| A0A1B1ZSN0 | 335-464 | None |
| A0A0X2NP18 | 43-220 | None |
| G7H7R8 | 35-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.