DPCstruct | MC1808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 16 aa |
| Standard deviation of domain lengths | 16.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0DS40 | 19-151 | GSTTTVGGKRKREDDDDNDKPSMDGEGKQAKIMKMLEEADEIEELDAARLRMLVQNFSKAIEKNVERRMKFADEPAKFMDSEVKVHT… |
| A0A183IC39 | 13-155 | TSIQQLFTWSSPVSKRPRAESSEDVISFLKKPKQSDPAIHNTASLPEESLSVLSNTEEQVDVMDENGVKKMILNFEKKILKNQEMRI… |
| A0A0E9NA74 | 24-171 | None |
| M4BHN6 | 6-126 | None |
| A0A7R8X0T1 | 355-481 | None |
| D8M185 | 2-160 | None |
| L9L385 | 1-155 | None |
| H9GU85 | 93-247 | None |
| A0A4D9D644 | 57-224 | None |
| A0A0V1L773 | 411-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.