DPCstruct | MC18075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 33 aa |
| Standard deviation of domain lengths | 32.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.28 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | CL0028- PF12551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1HK26 | 2-199 | SEETTRIPGLQTVWQLATQVGRIASTTAGLAGETGRVVAGTSEVEPEKGDKRFRDPTWDDHPLYRRLKQEYLACQQAIDGFVKGADL… |
| A0A2T6A3J5 | 13-161 | QAPGKQMELGVKAGRKWQRLMAHLMASAMDPQAAPVITPLPGDRRFAGEAWAKPPFSWMSQAFLLQQQWLHNVTHEVPGVTKHHEDV… |
| A0A349W9D4 | 2-213 | None |
| A0A7I7NVD1 | 2-170 | None |
| A0A0F3R8F7 | 4-191 | None |
| A0A558HWZ0 | 35-261 | None |
| A0A7X5BA23 | 51-252 | None |
| A0A4R6YB10 | 186-372 | None |
| A0A060NNB7 | 2-288 | None |
| A0A812VQC3 | 609-809 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.