DPCstruct | MC18071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 136 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.52 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF00696- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8U7Q4 | 1-140 | MDSKVKAATWALDRGVSVVICNGMQEKAIKTIIAGRKVGTFFTESTEGFSTPVDVLAENARIGSRQMQALSPEQRANAVNHLADLLV… |
| A0A2G3C5D9 | 693-831 | MTAKVKAAVYAAYAGIPVVITSGFANNNIIKALDGECVGTLFHREAIKWASTGDVDAREMAVSARECARRLQALSSQERSKILLDIA… |
| A0A2H1CUM4 | 94-212 | None |
| A0A7R9BSA5 | 557-686 | None |
| A0A1V9X4W4 | 294-438 | None |
| A0A453FXD5 | 136-274 | None |
| A0A3P6TBQ2 | 93-227 | None |
| A0A0A9CTE6 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.