DPCstruct | MC1807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 71.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FFD0 | 219-281 | ETSECGGYDGGQSSTLTPVHLRKAKLMFFYTRYPNSTLLKSYFPDVRFNKNNTAQLVKWFSNF |
| A0A183IAL5 | 29-99 | SETAIDYSEANGFDPGLSSLSCTLTPMHLRKAKLMFFFSRYPSSSLLKAFFPDIRFNKNNTAQLVKWFSNF |
| A0A3P7IHE3 | 293-354 | None |
| A0A2A3EHS0 | 32-94 | None |
| A0A835GNV9 | 4-65 | None |
| A0A1W7R9X0 | 663-740 | None |
| A0A7R8CSX9 | 214-290 | None |
| A0A7R9CTS1 | 1-65 | None |
| A0A6V7W1K8 | 35-100 | None |
| A0A0R3RMF4 | 414-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.