DPCstruct | MC18068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Standard deviation of domain lengths | 16.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8M1M1 | 1-152 | MSFGLDLPTLYGENYRGNFNPQTRNIAEAVICHRTHHCGECAAKPSKSCYEKLHFGYCLAEQTRKDGSIGICGERFQVNSPGGCGTH… |
| A0A177CE81 | 9-161 | LQLLYWGHWDSSLNLNTRNIRTKNVGQTHHCSVCSTKPKPQCYRELHLAFCIAKIELEGKPDICGERFCPKSPDGCGIHHYKNGFNE… |
| A0A6A5WY03 | 12-179 | None |
| A0A6A5X1B4 | 4-173 | None |
| A0A6A6YYA3 | 87-251 | None |
| A0A2V1ECP7 | 2-147 | None |
| A0A834VMH3 | 4-172 | None |
| A0A6A6ZHU5 | 7-206 | None |
| A0A7U2I5U6 | 5-190 | None |
| A0A317AM46 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.