DPCstruct | MC18066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 99 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.96 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF07927- CL0219- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3Y6G3 | 1-81 | MSKLDKLKKKLYKEPAPKDFTWDELKTLLLKLGFIEEQGSGSRVKFYHPELDYPINLHKPHPGNILKEYILKRIKETLDDL |
| A0A7C8IIE3 | 157-261 | EAAPEQGPIIVDKRAQRVFKALFHSPNSPDQPGEIAWPDFLHAMVSTGFSAEKLQGSAWQFTPRSLDVERSIQFHEPHPGNKLPFTW… |
| A0A3M7H473 | 249-356 | None |
| A0A3D4GNQ8 | 14-97 | None |
| A0A5C2SQD4 | 593-701 | None |
| A0A2V1DFB5 | 600-709 | None |
| A0A4S9KG94 | 406-490 | None |
| A0A853F3C9 | 58-140 | None |
| A0A081BRU8 | 1-100 | None |
| A0A6J5Z7Z7 | 6-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.