DPCstruct | MC18064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 228 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8I613 | 1-221 | MQRQVPNLDDFEEIAMNIPELSGNLRLVMSGLFQQLADHVRPKGNEYSGPWMLRADGRESDWARNKEPSLTVTSLSFPYFKLSSIKG… |
| A0A366Q3R2 | 1-210 | MNFDSLAADIQALPFLTTPQRKAISRLLSDVKKNSSRPIRFSKDTTVRHMDPGVRQLDIPPSKDSRDNHITPTPVTWLCIPYFSLER… |
| A0A017SGB7 | 107-322 | None |
| A0A6A5Y9R8 | 115-365 | None |
| A0A6A5V2A6 | 1-212 | None |
| A0A6A6E5K0 | 44-269 | None |
| W3X2G3 | 264-512 | None |
| A0A135UBH6 | 294-529 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.