DPCstruct | MC18062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 109 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9MPK7 | 6-112 | FLLQLELNLSNHMIFKIIKNSQDRCCEIGFLVLEDYRRPGTLEDFEYLKPVYEDGTFEWEDDGNLIVVSIYTYDEINQEEKESLLEL… |
| A0A3S0QNY0 | 1-120 | MFRFIRLLRMRDLEIIEVVHNSVKICLLIIEDKRRALNDSEKQLTPYNLMDENELKDEIHNVLYLYILTGEELTKQQNDSIIEFADD… |
| A0A0X1S0J1 | 68-178 | None |
| A0A1Q6U0W1 | 5-113 | None |
| A0A841YD05 | 2-116 | None |
| A0A2S0JNB1 | 1-101 | None |
| A0A7T2CGL6 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.