DPCstruct | MC1806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7DFZ7 | 4-77 | EFEFVCNRKWEDLIETGNETMRFCSHCSQNVYLARDNFQLEQLASKKLCAYFAPIESPKTTTEPYLELTGLLGR |
| A0A318IKF2 | 3-70 | TCNLSFICPKTWTELTQTEDLLTRYCDSCSQQVHWVDTQEDFDQAAADGKCVAFESQGTPMLGFPDGI |
| A0A2S9Y5V7 | 101-178 | None |
| A0A7W2NNV8 | 3-66 | None |
| A0A848LU82 | 11-85 | None |
| A0A2N4TJK2 | 20-91 | None |
| A0A812LS28 | 196-267 | None |
| K2JTH9 | 9-73 | None |
| A0A7S4R9Z5 | 187-255 | None |
| A0A4P6B0V7 | 13-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.