DPCstruct | MC18055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 221 ± 72 aa |
| Standard deviation of domain lengths | 72.01 |
| Length coefficient of variation | 0.33 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6KA95 | 43-230 | GPVNQPALDILAIRKIGEVKAGVAVSGKLPKPLVKLYSEPYMQDMDILAYIVLGHPLGADSKQAGLLATAAGAVLTSQQAEDLLEQI… |
| A0A0R2SVM5 | 22-167 | QTVGVQMGGTLKNMNSTLFSSPNLSETDILAMLATGRPFASIGQRDQGALLGTLASLGLERNSGLTNQIRSSLGLDELAIDTKDTLN… |
| A0A446N7B0 | 130-403 | None |
| A0A7C1IC38 | 1-116 | None |
| A0A2N5ZIM0 | 604-932 | None |
| A0A2A2TGY1 | 310-538 | None |
| A0A080LR83 | 9-153 | None |
| A0A536VPD4 | 863-1010 | None |
| A0A831P210 | 159-344 | None |
| A0A378W4B1 | 12-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.