DPCstruct | MC18052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 170 ± 23 aa |
| Standard deviation of domain lengths | 23.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0020- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517Z8G4 | 291-442 | RVIAAADAVIETIGEEVWTRSPEELSSRQQEVRQQLIDALYRKGRALAYMELPDVIARHPIIDQEEHDRRFEANFQQLARLVDTTER… |
| A0A2D4LWI1 | 28-217 | LHQLDSEKERMKSLNEIIEASNTVISHIDQTALAIYLAMKTDPRPDAATIKNEMEKQKSTLVDALCRKGCALSDQLLQLQALEGAAS… |
| A0A6H5GJE3 | 977-1105 | None |
| A0A024FYN2 | 27-211 | None |
| A0A4Z2HNY0 | 2-174 | None |
| A0A7S4DZJ1 | 195-387 | None |
| A0A7S0L4F2 | 59-242 | None |
| A0A672SJJ0 | 681-815 | None |
| A0A7R9MKW9 | 2-152 | None |
| A0A2G2X6T0 | 993-1170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.