DPCstruct | MC18051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JJS7 | 421-525 | DLIHQAYLSAQQGEWFHRPVIEMTIPSSKDLTLAPEGHHVVLLFTMYTPYELSGGRQWDDVTRGQYADCVFDSIERYAPGFKESVVG… |
| A0A2D4L9X7 | 1-98 | MIEMCIPSVLDPTLAPPGCHVISLFTQYTPYLLAGEKQWHSRDREDYANRVFDSVEAYAPGFKASIIGTDVLTPPDLEKIFGLPGGV… |
| A0A314YT69 | 399-522 | None |
| A0A5S9M893 | 22-120 | None |
| D8QXF4 | 755-857 | None |
| A0A821QNP1 | 2-99 | None |
| A0A834TUK8 | 1-122 | None |
| A0A8A6S2A5 | 10-125 | None |
| A0A821BAA2 | 2-105 | None |
| A0A2G9UVR2 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.