DPCstruct | MC18050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 387 |
|---|---|
| Mean domain length (aa) | 144 ± 30 aa |
| Standard deviation of domain lengths | 29.76 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.13 |
| Pfam Score | 81.85 |
| Assigned Pfam label(s) | CL0291- PF01390- PF01967- PF17619- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J6G2 | 1-115 | LEIRVTERDGDKLIYSSDYGSPNSPNYVDIVDKFKKGLGELIKKTTSGPSFVADDVNYITNPKIKNSTWDKGLLVNATADFKSPVDK… |
| A0A2D4L877 | 19-153 | ASPQTTLPPTSKPPVATECFTINFIATNLIYRPQMANPKSKIFSSTQRYFVNLLRDILKNSDIGPDLINCRLSTLRSVNQKRYSGVD… |
| A0A2B4S9F6 | 302-412 | None |
| A0A5N3W625 | 9-151 | None |
| K7F747 | 133-299 | None |
| C3ZG05 | 550-671 | None |
| A0A1S3Q112 | 282-476 | None |
| A0A6P8HK90 | 330-478 | None |
| A0A2B4SQY7 | 390-531 | None |
| A0A2B4SDW3 | 211-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.