DPCstruct | MC18048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 2 aa |
| Standard deviation of domain lengths | 1.61 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 77.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9N440 | 1-104 | MKGNIDIKKYLVPNLPYVMMFWFFSKITEGYRLSAGTDAVTKAMAAVSGLGATITANPFPSFHPHDLLIGIAGAAAVRAVVYFKGKN… |
| A0A174CY93 | 60-158 | ADQKKLFLANFPYLMFAYFFNKIAWLYRVNTGATSWDKFMNTITYFELAFQNLWPSLNHIDLLCGIAGGVAVKLIIIYRTKNARKYR… |
| D4LWM0 | 19-122 | None |
| A0A417BRY3 | 2-103 | None |
| A0A415LIT6 | 59-158 | None |
| A0A1C6IE79 | 1-102 | None |
| A0A7U9RDK3 | 26-126 | None |
| A0A3A9A357 | 1-101 | None |
| A0A1C5XYH3 | 6-107 | None |
| A0A1G9M358 | 60-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.