DPCstruct | MC18047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5XXL7 | 2-124 | ADTDFNEKAFDMIGPNAPQDVKDAWMEAAKEVNANGMGIKKNGMLSHISQMMIQRLNKQMKGEGDVDNIDILGNTTESAIQATKQAL… |
| R9N357 | 21-184 | NGTPTFAQYVTEKNEERLRDEAATDFEERVLQSAGPNAPQSVKDAWMETVKEVGVNGLGETKNGRTHITDMHIQQIIAHYYGLSNST… |
| A0A1H7QPI2 | 97-209 | None |
| A0A7X3MLD3 | 3-177 | None |
| A0A4R1MY94 | 177-309 | None |
| A0A3A9AAF3 | 1-171 | None |
| A0A3A9GCL4 | 291-408 | None |
| A0A7X3MMC3 | 1-130 | None |
| A0A7U9N375 | 157-301 | None |
| A0A3R6CKX1 | 444-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.