DPCstruct | MC18046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9MQA6 | 21-86 | KKKLIIVFAVIAAVLLLIPVRKVYEDGGTQTYTSLTYKVIVWKQIDGKSGTELYLFPNNFHQLDYY |
| A0A2X1XXW2 | 2-62 | RKKLLILLIILILCFPIRYRYKDGGTVSYKAILYSYTIYHRLESDESYYRGREFLIFPFNF |
| A0A2G6G8U1 | 1-73 | None |
| R7L9D0 | 1-65 | None |
| D4MQF7 | 3-70 | None |
| A0A1I1RX28 | 4-70 | None |
| A0A2G6PK54 | 1-76 | None |
| A0A1G8CDQ5 | 3-71 | None |
| A0A358PJI5 | 3-75 | None |
| A0A1I6LJY3 | 4-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.