DPCstruct | MC18045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814XXM2 | 7-134 | VPFIPGLDLCERFFFDLVKPLLDKDYPSLEYVACRLGEGSDVLGFDTNQSRDHDWGPKFDLLLEDEQHIDELNTFFSKHLRGKLICG… |
| A0A818NIM4 | 7-129 | IPFIHGLDLSERFFFDIVKPLLDEYYPSLQYTACRLGHGSDVLGFDTNQSRDHDWGPKFDLLLENETHIDELELFFNKNLREKTICG… |
| A0A7T8YMG5 | 1-101 | None |
| A0A2A5A9M3 | 1-125 | None |
| A0A2V8QXJ4 | 1-130 | None |
| D6T0H8 | 102-223 | None |
| A0A5M7C9T8 | 115-236 | None |
| A0A164Q198 | 1-108 | None |
| A0A7Z0BD63 | 3-112 | None |
| A0A3D3J582 | 274-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.