DPCstruct | MC18043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 453 ± 115 aa |
| Standard deviation of domain lengths | 114.51 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7IRB3 | 12-374 | VPVPFSEWRDITTFILLDVLKCQYGKISIGRQEQSLGTYPALSKFRAPSCADQRIGLESSTKPSARTHRVRKPVPNLEIDDVCVNNG… |
| A0A818MPN3 | 68-547 | LWQFVNRPNPNPSHHCMHEWVSVSPHSAKLRQFYQGSHKCKVKLVSATQSISQSHFSTPRQVVPIPVDEFLYENSLRVQISPTKIIE… |
| A0A5N6E6D4 | 2-580 | None |
| A0A2V1CYR8 | 1-275 | None |
| C4JQK6 | 10-319 | None |
| A0A817NRZ6 | 2-303 | None |
| A0A820VLA5 | 4-280 | None |
| A0A420H8R7 | 7-554 | None |
| W7MJ48 | 86-608 | None |
| A0A0C3AR72 | 516-968 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.