DPCstruct | MC18041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 138 ± 31 aa |
| Standard deviation of domain lengths | 30.57 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1ATS4 | 126-249 | KATEEYITEFGKALDPELSLIWTGREICSEYLDVFDAKVFKANTNHTPLYWDNYPVNDVAMLHELHVGPIEGREKGLEDHSLGYFAN… |
| A0A818KIG0 | 4-156 | KHWPFWVLVSVESRKVVSQDITVSHLLSINNILKRRVIIWDNLNANDYDQRRLCMGPYTGRSLNISNEINGILLNPNCEFELNFIPL… |
| A0A2P4S8K2 | 70-203 | None |
| A0A818E907 | 541-731 | None |
| A0A817M5Q8 | 1-137 | None |
| A0A183J9M5 | 7-148 | None |
| A0A2P8XXN9 | 152-276 | None |
| A0A368GAR2 | 41-190 | None |
| A0A3Q2UFK7 | 136-278 | None |
| A0A651EEG3 | 375-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.