DPCstruct | MC1804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0TH55 | 1-64 | MEEIIEKVCQHLPINYTVLLCMENGSAYVELRDPLTLPVELPDATDKSLCEQLNDALCVANGFK |
| A0A366F9C5 | 25-103 | LSVGERDALVAMARDGAAILRAATELPFGYHIELYVEAGYAGAKMIDPDGEPVDLDQDERNLALEINAAIDAAMAKDAS |
| A0A7V8JJS6 | 5-76 | None |
| A0A522RNV6 | 1-65 | None |
| A0A5E4SFW9 | 54-119 | None |
| A0A1H9JSD7 | 106-186 | None |
| A0A0P9Y668 | 76-151 | None |
| A0A103QVR8 | 53-140 | None |
| A0A162HDB7 | 39-116 | None |
| A0A1B4G139 | 593-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.